PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G182000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 438aa    MW: 49033.3 Da    PI: 7.5323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G182000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Manes.09G182000.1.p 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding44.43.9e-1467110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Manes.09G182000.1.p  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466891.76E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-161461IPR001005SANT/Myb domain
CDDcd001679.59E-121761No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.12666116IPR017930Myb domain
SMARTSM007172.9E-1266114IPR001005SANT/Myb domain
PfamPF002494.7E-1367110IPR001005SANT/Myb domain
CDDcd001678.56E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKPLS EVENDYKEKP PTNNKNNDKA FTVSNVNELN LIEPANSKPS TVSSSSKLTT  180
NNDHSSSNLT PTPPTQEFFL DRFASSHDSS TTSCRPSDLV GYFSFQKLSY KPNICFNSNS  240
SSSEMISEFN SCMTPTILPP ISSSMFQTSI TVKPSISLPS DNPNSIGSCE VNGIQTWETS  300
GFNNSGSSCS NGSSSSIELQ NNTTFFDTNT FSWGLPDCGK PGEEAHLRSL ENEQDIKWSE  360
YLSTPFLIGT TAIQNQTSQP MYSEVKPETH FITEGSSTSW QQNHQHHQYH HHSQTSQPSE  420
NYAKNLQRLA VAFGQTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017491e-129JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015584638.10.0PREDICTED: transcription factor MYB86
TrEMBLB9I6B70.0B9I6B7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s00290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-112myb domain protein 61